Lineage for d1f3rb2 (1f3r B:139-257)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2022563Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2023437Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)
  8. 2023454Domain d1f3rb2: 1f3r B:139-257 [20417]
    Other proteins in same PDB: d1f3rb1
    part of scFv MAB198 against the main immunogenic region of the human muscle acetylcholine receptor; order: VH-linker-VL

Details for d1f3rb2

PDB Entry: 1f3r (more details)

PDB Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor
PDB Compounds: (B:) fv antibody fragment

SCOPe Domain Sequences for d1f3rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkaaeqkliseedln

SCOPe Domain Coordinates for d1f3rb2:

Click to download the PDB-style file with coordinates for d1f3rb2.
(The format of our PDB-style files is described here.)

Timeline for d1f3rb2: