SCOP 1.75: Domain d1f3rb2: 1f3r B:139-257

Lineage for d1f3rb2 (1f3r B:139-257)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)

8. Domain d1f3rb2: 1f3r B:139-257 [20417]
   Other proteins in same PDB: d1f3rb1
   part of scFv MAB198 against the main immunogenic region of the human muscle acetylcholine receptor; order: VH-linker-VL
   mutant

Details for d1f3rb2

PDB Entry: 1f3r

PDB Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor

PDB Compounds: (B:) fv antibody fragment

SCOP Domain Sequences for d1f3rb2:

Sequence; same for both SEQRES and ATOM records:

>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkaaeqkliseedln

Timeline for d1f3rb2:

• d1f3rb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3rb2 appears in SCOP 1.73
  
• d1f3rb2 appears in SCOPe 2.01
  
• d1f3rb2 appears in the current release, SCOPe 2.08