SCOP 1.63: Domain d1f3rb2: 1f3r B:139-257

Lineage for d1f3rb2 (1f3r B:139-257)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species scFv MAB198, (rat), kappa L chain [48887] (1 PDB entry)
   against the main immunogenic region of the human muscle acetylcholine receptor

8. Domain d1f3rb2: 1f3r B:139-257 [20417]
   order: VH-linker-VL)
   mutant

Details for d1f3rb2

PDB Entry: 1f3r

PDB Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor

SCOP Domain Sequences for d1f3rb2:

Sequence; same for both SEQRES and ATOM records:

>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin (variable domains of L and H chains) {scFv MAB198, (rat), kappa L chain}
dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkaaeqkliseedln

Timeline for d1f3rb2:

• d1f3rb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f3rb2 appears in SCOP 1.61
  
• d1f3rb2 appears in SCOP 1.65
  
• d1f3rb2 appears in the current release, SCOPe 2.08