SCOPe 2.04: Domain d2eytd1: 2eyt D:3-119

Lineage for d2eytd1 (2eyt D:3-119)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2eytd1: 2eyt D:3-119 [204169]
   Other proteins in same PDB: d2eyta2, d2eytb2, d2eytc2, d2eytd2
   automated match to d1qrne1

Details for d2eytd1

PDB Entry: 2eyt, 2.6 Å

PDB Description: A structural basis for selection and cross-species reactivity of the semi-invariant NKT cell receptor in CD1d/glycolipid recognition

PDB Compounds: (D:) nkt15

SCOPe Domain Sequences for d2eytd1:

Sequence; same for both SEQRES and ATOM records:

>d2eytd1 b.1.1.0 (D:3-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss
estvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvted

Timeline for d2eytd1:

• d2eytd1 first appeared in SCOPe 2.03
  
• d2eytd1 appears in SCOPe 2.05
  
• d2eytd1 appears in the current release, SCOPe 2.08