Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
Domain d2eytd1: 2eyt D:3-119 [204169] Other proteins in same PDB: d2eyta2, d2eytb2, d2eytc2, d2eytd2 automated match to d1qrne1 |
PDB Entry: 2eyt (more details), 2.6 Å
SCOPe Domain Sequences for d2eytd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eytd1 b.1.1.0 (D:3-119) automated matches {Human (Homo sapiens) [TaxId: 9606]} diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss estvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvted
Timeline for d2eytd1: