SCOPe 2.06: Domain d2eytc2: 2eyt C:118-205

Lineage for d2eytc2 (2eyt C:118-205)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d2eytc2: 2eyt C:118-205 [204168]
Other proteins in same PDB: d2eyta1, d2eytb1, d2eytc1, d2eytd1
automated match to d1qrnd2

Details for d2eytc2

PDB Entry: 2eyt (more details), 2.6 Å

PDB Description: A structural basis for selection and cross-species reactivity of the semi-invariant NKT cell receptor in CD1d/glycolipid recognition

PDB Compounds: (C:) nkt15

SCOPe Domain Sequences for d2eytc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eytc2 b.1.1.2 (C:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d2eytc2:

Click to download the PDB-style file with coordinates for d2eytc2.
(The format of our PDB-style files is described here.)

Timeline for d2eytc2: