Lineage for d2eyta2 (2eyt A:118-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750757Domain d2eyta2: 2eyt A:118-205 [204164]
    Other proteins in same PDB: d2eyta1, d2eytb1, d2eytc1, d2eytd1
    automated match to d1qrnd2

Details for d2eyta2

PDB Entry: 2eyt (more details), 2.6 Å

PDB Description: A structural basis for selection and cross-species reactivity of the semi-invariant NKT cell receptor in CD1d/glycolipid recognition
PDB Compounds: (A:) nkt15

SCOPe Domain Sequences for d2eyta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyta2 b.1.1.2 (A:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d2eyta2:

Click to download the PDB-style file with coordinates for d2eyta2.
(The format of our PDB-style files is described here.)

Timeline for d2eyta2: