SCOPe 2.06: Domain d2eyia1: 2eyi A:30-141

Lineage for d2eyia1 (2eyi A:30-141)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (30 PDB entries)

8. Domain d2eyia1: 2eyi A:30-141 [204151]
   Other proteins in same PDB: d2eyia3, d2eyia4
   automated match to d1sh5a1

Details for d2eyia1

PDB Entry: 2eyi, 1.7 Å

PDB Description: crystal structure of the actin-binding domain of human alpha-actinin 1 at 1.7 angstrom resolution

PDB Compounds: (A:) Alpha-actinin 1

SCOPe Domain Sequences for d2eyia1:

Sequence; same for both SEQRES and ATOM records:

>d2eyia1 a.40.1.0 (A:30-141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekqqrktftawcnshlrkagtqienieedfrdglklmlllevisgerlakpergkmrvhk
isnvnkaldfiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisv

Timeline for d2eyia1:

• d2eyia1 first appeared in SCOPe 2.03
  
• d2eyia1 appears in SCOPe 2.05
  
• d2eyia1 appears in SCOPe 2.07
  
• d2eyia1 appears in the current release, SCOPe 2.08