Lineage for d1c5db1 (1c5d B:1-117)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219565Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [48886] (1 PDB entry)
  8. 219567Domain d1c5db1: 1c5d B:1-117 [20415]
    Other proteins in same PDB: d1c5da2, d1c5db2, d1c5dh2, d1c5dl2

Details for d1c5db1

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain}
evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn
salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvss

SCOP Domain Coordinates for d1c5db1:

Click to download the PDB-style file with coordinates for d1c5db1.
(The format of our PDB-style files is described here.)

Timeline for d1c5db1: