Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [48886] (1 PDB entry) |
Domain d1c5db1: 1c5d B:1-117 [20415] Other proteins in same PDB: d1c5da2, d1c5db2, d1c5dh2, d1c5dl2 |
PDB Entry: 1c5d (more details), 2.4 Å
SCOP Domain Sequences for d1c5db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain} evkllesgpglvqpsqtlsltctvsgfplttngvswvrqppgkglewiaaissggspyyn salksrlsinrdtsksqvflkmnslqtedtaiyfctredgwnyfdywgpgtmvtvss
Timeline for d1c5db1: