SCOP 1.55: Domain d1c5da1: 1c5d A:1-106

Lineage for d1c5da1 (1c5d A:1-106)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [48886] (1 PDB entry)

8. Domain d1c5da1: 1c5d A:1-106 [20414]
   Other proteins in same PDB: d1c5da2, d1c5db2, d1c5dh2, d1c5dl2

Details for d1c5da1

PDB Entry: 1c5d, 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5da1:

Sequence; same for both SEQRES and ATOM records:

>d1c5da1 b.1.1.1 (A:1-106) Immunoglobulin (variable domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain}
diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleik

Timeline for d1c5da1:

• d1c5da1 appears in SCOP 1.57
  
• d1c5da1 appears in the current release, SCOPe 2.08