Lineage for d2epfd2 (2epf D:154-210)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261052Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 2261053Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 2261066Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 2261067Protein automated matches [226858] (4 species)
    not a true protein
  7. 2261085Species Pseudechis porphyriacus [TaxId:8671] [225220] (2 PDB entries)
  8. 2261093Domain d2epfd2: 2epf D:154-210 [204139]
    Other proteins in same PDB: d2epfa1, d2epfb1, d2epfc1, d2epfd1
    automated match to d1rc9a2
    complexed with na, zn

Details for d2epfd2

PDB Entry: 2epf (more details), 2.3 Å

PDB Description: Crystal Structure of Zinc-Bound Pseudecin From Pseudechis Porphyriacus
PDB Compounds: (D:) Pseudecin

SCOPe Domain Sequences for d2epfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2epfd2 g.19.1.0 (D:154-210) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
ppcadcpsacvnrlctnpcnynndfsnckslakkskcqtewikkkcpascfchnkii

SCOPe Domain Coordinates for d2epfd2:

Click to download the PDB-style file with coordinates for d2epfd2.
(The format of our PDB-style files is described here.)

Timeline for d2epfd2: