Lineage for d2epfd1 (2epf D:4-153)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923144Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 1923145Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 1923174Family d.111.1.0: automated matches [227200] (1 protein)
    not a true family
  6. 1923175Protein automated matches [226929] (3 species)
    not a true protein
  7. 1923181Species Pseudechis porphyriacus [TaxId:8671] [225219] (2 PDB entries)
  8. 1923189Domain d2epfd1: 2epf D:4-153 [204138]
    Other proteins in same PDB: d2epfa2, d2epfb2, d2epfc2, d2epfd2
    automated match to d1rc9a1
    complexed with na, zn

Details for d2epfd1

PDB Entry: 2epf (more details), 2.3 Å

PDB Description: Crystal Structure of Zinc-Bound Pseudecin From Pseudechis Porphyriacus
PDB Compounds: (D:) Pseudecin

SCOPe Domain Sequences for d2epfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2epfd1 d.111.1.0 (D:4-153) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
kcssskylyvcqycpagnirgsiatpyksg

SCOPe Domain Coordinates for d2epfd1:

Click to download the PDB-style file with coordinates for d2epfd1.
(The format of our PDB-style files is described here.)

Timeline for d2epfd1: