Lineage for d2epfb2 (2epf B:154-210)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964007Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 1964008Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 1964021Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 1964022Protein automated matches [226858] (4 species)
    not a true protein
  7. 1964040Species Pseudechis porphyriacus [TaxId:8671] [225220] (2 PDB entries)
  8. 1964046Domain d2epfb2: 2epf B:154-210 [204135]
    Other proteins in same PDB: d2epfa1, d2epfb1, d2epfc1, d2epfd1
    automated match to d1rc9a2
    complexed with na, zn

Details for d2epfb2

PDB Entry: 2epf (more details), 2.3 Å

PDB Description: Crystal Structure of Zinc-Bound Pseudecin From Pseudechis Porphyriacus
PDB Compounds: (B:) Pseudecin

SCOPe Domain Sequences for d2epfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2epfb2 g.19.1.0 (B:154-210) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
ppcadcpsacvnrlctnpcnynndfsnckslakkskcqtewikkkcpascfchnkii

SCOPe Domain Coordinates for d2epfb2:

Click to download the PDB-style file with coordinates for d2epfb2.
(The format of our PDB-style files is described here.)

Timeline for d2epfb2: