Lineage for d2epfa1 (2epf A:4-153)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211337Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2211338Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2211368Family d.111.1.0: automated matches [227200] (1 protein)
    not a true family
  6. 2211369Protein automated matches [226929] (4 species)
    not a true protein
  7. 2211375Species Pseudechis porphyriacus [TaxId:8671] [225219] (2 PDB entries)
  8. 2211380Domain d2epfa1: 2epf A:4-153 [204132]
    Other proteins in same PDB: d2epfa2, d2epfb2, d2epfc2, d2epfd2
    automated match to d1rc9a1
    complexed with na, zn

Details for d2epfa1

PDB Entry: 2epf (more details), 2.3 Å

PDB Description: Crystal Structure of Zinc-Bound Pseudecin From Pseudechis Porphyriacus
PDB Compounds: (A:) Pseudecin

SCOPe Domain Sequences for d2epfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2epfa1 d.111.1.0 (A:4-153) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
kcssskylyvcqycpagnirgsiatpyksg

SCOPe Domain Coordinates for d2epfa1:

Click to download the PDB-style file with coordinates for d2epfa1.
(The format of our PDB-style files is described here.)

Timeline for d2epfa1: