SCOP 1.63: Domain d1c5dl1: 1c5d L:1-106

Lineage for d1c5dl1 (1c5d L:1-106)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [48886] (1 PDB entry)
Domain d1c5dl1: 1c5d L:1-106 [20412]
Other proteins in same PDB: d1c5da2, d1c5db2, d1c5dh2, d1c5dl2

Details for d1c5dl1

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5dl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain}
diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleik

SCOP Domain Coordinates for d1c5dl1:

Click to download the PDB-style file with coordinates for d1c5dl1.
(The format of our PDB-style files is described here.)

Timeline for d1c5dl1: