Lineage for d1c5dl1 (1c5d L:1-106)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102523Species Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain [48886] (1 PDB entry)
  8. 102527Domain d1c5dl1: 1c5d L:1-106 [20412]
    Other proteins in same PDB: d1c5da2, d1c5db2, d1c5dh2, d1c5dl2

Details for d1c5dl1

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5dl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab against the main immunogenic region of the human muscle acetylcholine receptor, (rat), kappa L chain}
diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleik

SCOP Domain Coordinates for d1c5dl1:

Click to download the PDB-style file with coordinates for d1c5dl1.
(The format of our PDB-style files is described here.)

Timeline for d1c5dl1: