SCOPe 2.06: Domain d2egga2: 2egg A:123-297

Lineage for d2egga2 (2egg A:123-297)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)

7. Species Geobacillus kaustophilus [TaxId:1462] [225426] (1 PDB entry)

8. Domain d2egga2: 2egg A:123-297 [204117]
   Other proteins in same PDB: d2egga1, d2egga3, d2eggb1, d2eggb3
   automated match to d1nvta1
   complexed with cl

Details for d2egga2

PDB Entry: 2egg, 2.25 Å

PDB Description: crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus

PDB Compounds: (A:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d2egga2:

Sequence; same for both SEQRES and ATOM records:

>d2egga2 c.2.1.7 (A:123-297) Shikimate 5-dehydrogenase AroE {Geobacillus kaustophilus [TaxId: 1462]}
dglgyvqaleeemnitldgkrilvigagggargiyfsllstaaeridmanrtvekaerlv
regderrsayfslaeaetrlaeydiiinttsvgmhprvevqplslerlrpgvivsdiiyn
pletkwlkeakargarvqngvgmlvyqgalafekwtgqwpdvnrmkqlviealrr

Timeline for d2egga2:

• d2egga2 first appeared in SCOPe 2.03
  
• d2egga2 appears in SCOPe 2.05
  
• d2egga2 appears in SCOPe 2.07
  
• d2egga2 appears in the current release, SCOPe 2.08