Lineage for d2ebag2 (2eba G:234-385)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267383Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1267512Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1267513Protein automated matches [226935] (15 species)
    not a true protein
  7. 1267624Species Thermus thermophilus [TaxId:300852] [225241] (1 PDB entry)
  8. 1267630Domain d2ebag2: 2eba G:234-385 [204103]
    Other proteins in same PDB: d2ebaa1, d2ebac1, d2ebad1, d2ebae1, d2ebaf1, d2ebag1, d2ebah1, d2ebai1
    automated match to d1siqa1
    complexed with fad

Details for d2ebag2

PDB Entry: 2eba (more details), 2.21 Å

PDB Description: Crystal structure of the putative glutaryl-CoA dehydrogenase from thermus thermophilus
PDB Compounds: (G:) Putative glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2ebag2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebag2 a.29.3.0 (G:234-385) automated matches {Thermus thermophilus [TaxId: 300852]}
lkaplscltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlaw
hteglllawrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhair
hmlnletvytyegthdvhtlvlgreitglnaf

SCOPe Domain Coordinates for d2ebag2:

Click to download the PDB-style file with coordinates for d2ebag2.
(The format of our PDB-style files is described here.)

Timeline for d2ebag2: