Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (17 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225240] (1 PDB entry) |
Domain d2ebad1: 2eba D:1-233 [204096] Other proteins in same PDB: d2ebaa2, d2ebac2, d2ebad2, d2ebae2, d2ebaf2, d2ebag2, d2ebah2, d2ebai2 automated match to d1siqa2 complexed with fad |
PDB Entry: 2eba (more details), 2.21 Å
SCOPe Domain Sequences for d2ebad1:
Sequence, based on SEQRES records: (download)
>d2ebad1 e.6.1.0 (D:1-233) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalg
>d2ebad1 e.6.1.0 (D:1-233) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalg
Timeline for d2ebad1: