Lineage for d2ebac1 (2eba C:1-233)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246406Species Thermus thermophilus HB8 [TaxId:300852] [225240] (1 PDB entry)
  8. 2246408Domain d2ebac1: 2eba C:1-233 [204094]
    Other proteins in same PDB: d2ebaa2, d2ebac2, d2ebad2, d2ebae2, d2ebaf2, d2ebag2, d2ebah2, d2ebai2
    automated match to d1siqa2
    complexed with fad

Details for d2ebac1

PDB Entry: 2eba (more details), 2.21 Å

PDB Description: Crystal structure of the putative glutaryl-CoA dehydrogenase from thermus thermophilus
PDB Compounds: (C:) Putative glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2ebac1:

Sequence, based on SEQRES records: (download)

>d2ebac1 e.6.1.0 (C:1-233) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalg

Sequence, based on observed residues (ATOM records): (download)

>d2ebac1 e.6.1.0 (C:1-233) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalg

SCOPe Domain Coordinates for d2ebac1:

Click to download the PDB-style file with coordinates for d2ebac1.
(The format of our PDB-style files is described here.)

Timeline for d2ebac1: