SCOP 1.63: Domain d1ct8b1: 1ct8 B:1-113

Lineage for d1ct8b1 (1ct8 B:1-113)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Catalytic Fab 7C8, (mouse), kappa L chain [48885] (1 PDB entry)

8. Domain d1ct8b1: 1ct8 B:1-113 [20409]
   Other proteins in same PDB: d1ct8a2, d1ct8b2, d1ct8c2, d1ct8d2

Details for d1ct8b1

PDB Entry: 1ct8, 2.2 Å

PDB Description: catalytic antibody 7c8 complex

SCOP Domain Sequences for d1ct8b1:

Sequence; same for both SEQRES and ATOM records:

>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain}
qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsa

Timeline for d1ct8b1:

• d1ct8b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ct8b1 appears in SCOP 1.61
  
• d1ct8b1 appears in SCOP 1.65
  
• d1ct8b1 appears in the current release, SCOPe 2.08