Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Catalytic Fab 7C8, (mouse), kappa L chain [48885] (1 PDB entry) |
Domain d1ct8a1: 1ct8 A:1-107 [20408] Other proteins in same PDB: d1ct8a2, d1ct8b2, d1ct8c2, d1ct8d2 |
PDB Entry: 1ct8 (more details), 2.2 Å
SCOP Domain Sequences for d1ct8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ct8a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain} elvmtqtpatlsvtpgdsvslscrasqsvsnklhwyqqkshesprllikfasqsipgips rfsgsgsgsdftlsinsvetedfgiyfchqthgrpltfgagtklelk
Timeline for d1ct8a1: