Lineage for d1ct8a1 (1ct8 A:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51961Species Catalytic Fab 7C8, (mouse), kappa L chain [48885] (1 PDB entry)
  8. 51962Domain d1ct8a1: 1ct8 A:1-107 [20408]
    Other proteins in same PDB: d1ct8a2, d1ct8b2, d1ct8c2, d1ct8d2

Details for d1ct8a1

PDB Entry: 1ct8 (more details), 2.2 Å

PDB Description: catalytic antibody 7c8 complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1ct8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct8a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain}
elvmtqtpatlsvtpgdsvslscrasqsvsnklhwyqqkshesprllikfasqsipgips
rfsgsgsgsdftlsinsvetedfgiyfchqthgrpltfgagtklelk

SCOP Domain Coordinates for d1ct8a1:

Click to download the PDB-style file with coordinates for d1ct8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ct8a1: