SCOPe 2.03: Domain d2e40a_: 2e40 A:

Lineage for d2e40a_ (2e40 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (46 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [225236] (2 PDB entries)

8. Domain d2e40a_: 2e40 A: [204078]
   automated match to d3ahxa_
   complexed with lgc

Details for d2e40a_

PDB Entry: 2e40, 1.9 Å

PDB Description: crystal structure of intracellular family 1 beta-glucosidase bgl1a from the basidiomycete phanerochaete chrysosporium in complex with gluconolactone

PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2e40a_:

Sequence; same for both SEQRES and ATOM records:

>d2e40a_ c.1.8.0 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
aklpksfvwgyataayqiegspdkdgrepsiwdtfckapgkiadgssgdvatdsynrwre
dvqllksygvkayrfslswsriipkggrsdpvngagikhyrtlieelvkegitpfvtlyh
wdlpqalddryggwlnkeeaiqdftnyaklcfesfgdlvqnwitfnepwvisvmgygngi
fapghvsntepwivshhiilahahavklyrdefkekqggqigitldshwlipyddtdask
eatlramefklgrfanpiykgeypprikkilgdrlpeftpeeielvkgssdffglntytt
hlvqdggsdelagfvktghtradgtqlgtqsdmgwlqtygpgfrwllnylwkaydkpvyv
tengfpvkgendlpveqavddtdrqayyrdyteallqavtedgadvrgyfgwslldnfew
aegykvrfgvthvdyetqkrtpkksaeflsrwfkehiee

Timeline for d2e40a_:

• d2e40a_ is new in SCOPe 2.03-stable
  
• d2e40a_ appears in SCOPe 2.04
  
• d2e40a_ appears in the current release, SCOPe 2.08