Lineage for d1r24c1 (1r24 C:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52522Species Fab R24, (mouse), kappa L chain [48884] (2 PDB entries)
  8. 52527Domain d1r24c1: 1r24 C:1-107 [20406]
    Other proteins in same PDB: d1r24a2, d1r24b2, d1r24c2, d1r24d2

Details for d1r24c1

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24c1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab R24, (mouse), kappa L chain}
diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleik

SCOP Domain Coordinates for d1r24c1:

Click to download the PDB-style file with coordinates for d1r24c1.
(The format of our PDB-style files is described here.)

Timeline for d1r24c1: