Lineage for d1r24b1 (1r24 B:1-122)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546768Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)
  8. 546824Domain d1r24b1: 1r24 B:1-122 [20405]
    Other proteins in same PDB: d1r24a1, d1r24a2, d1r24b2, d1r24c1, d1r24c2, d1r24d2

Details for d1r24b1

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
ss

SCOP Domain Coordinates for d1r24b1:

Click to download the PDB-style file with coordinates for d1r24b1.
(The format of our PDB-style files is described here.)

Timeline for d1r24b1: