SCOP 1.61: Domain d1r24b1: 1r24 B:1-122

Lineage for d1r24b1 (1r24 B:1-122)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab R24, (mouse), kappa L chain [48884] (2 PDB entries)

8. Domain d1r24b1: 1r24 B:1-122 [20405]
   Other proteins in same PDB: d1r24a2, d1r24b2, d1r24c2, d1r24d2

Details for d1r24b1

PDB Entry: 1r24, 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24b1:

Sequence; same for both SEQRES and ATOM records:

>d1r24b1 b.1.1.1 (B:1-122) Immunoglobulin (variable domains of L and H chains) {Fab R24, (mouse), kappa L chain}
dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
ss

Timeline for d1r24b1:

• d1r24b1 first appeared (with stable ids) in SCOP 1.55
  
• d1r24b1 appears in SCOP 1.59
  
• d1r24b1 appears in SCOP 1.63
  
• d1r24b1 appears in the current release, SCOPe 2.08