Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (3 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.0: automated matches [227173] (1 protein) not a true family |
Protein automated matches [226888] (2 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225078] (2 PDB entries) |
Domain d2dwqa2: 2dwq A:284-368 [204044] Other proteins in same PDB: d2dwqa1, d2dwqb1 automated match to d1jala2 |
PDB Entry: 2dwq (more details), 2.95 Å
SCOPe Domain Sequences for d2dwqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dwqa2 d.15.10.0 (A:284-368) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} lltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdklveaggwarake rgwvrlegkdyevqdgdviyvlfna
Timeline for d2dwqa2: