Lineage for d2dvva_ (2dvv A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1487795Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)
  8. 1487911Domain d2dvva_: 2dvv A: [204042]
    automated match to d1x0jb_
    complexed with epe

Details for d2dvva_

PDB Entry: 2dvv (more details), 1.8 Å

PDB Description: Crystal structure of the second bromodomain of the human Brd2 protein
PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2dvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvva_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

SCOPe Domain Coordinates for d2dvva_:

Click to download the PDB-style file with coordinates for d2dvva_.
(The format of our PDB-style files is described here.)

Timeline for d2dvva_: