Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab R24, (mouse), kappa L chain [48884] (2 PDB entries) |
Domain d1bz7b1: 1bz7 B:1-122 [20403] Other proteins in same PDB: d1bz7a2, d1bz7b2 |
PDB Entry: 1bz7 (more details), 2.5 Å
SCOP Domain Sequences for d1bz7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin (variable domains of L and H chains) {Fab R24, (mouse), kappa L chain} dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv ss
Timeline for d1bz7b1: