Lineage for d1bz7a1 (1bz7 A:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7838Species Fab R24, (mouse), kappa L chain [48884] (2 PDB entries)
  8. 7839Domain d1bz7a1: 1bz7 A:1-107 [20402]
    Other proteins in same PDB: d1bz7a2, d1bz7b2

Details for d1bz7a1

PDB Entry: 1bz7 (more details), 2.5 Å

PDB Description: fab fragment from murine ascites

SCOP Domain Sequences for d1bz7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz7a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab R24, (mouse), kappa L chain}
diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleik

SCOP Domain Coordinates for d1bz7a1:

Click to download the PDB-style file with coordinates for d1bz7a1.
(The format of our PDB-style files is described here.)

Timeline for d1bz7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bz7a2