SCOP 1.63: Domain d43cae_: 43ca E:

Lineage for d43cae_ (43ca E:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain [48883] (2 PDB entries)

8. Domain d43cae_: 43ca E: [20398]

Details for d43cae_

PDB Entry: 43ca, 2.3 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol

SCOP Domain Sequences for d43cae_:

Sequence; same for both SEQRES and ATOM records:

>d43cae_ b.1.1.1 (E:) Immunoglobulin (variable domains of L and H chains) {Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain}
dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik

Timeline for d43cae_:

• d43cae_ first appeared (with stable ids) in SCOP 1.55
  
• d43cae_ appears in SCOP 1.61
  
• d43cae_ appears in SCOP 1.65
  
• d43cae_ appears in the current release, SCOPe 2.08