Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.0: automated matches [227186] (1 protein) not a true family |
Protein automated matches [226908] (3 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [225135] (3 PDB entries) |
Domain d2deia2: 2dei A:179-350 [203972] Other proteins in same PDB: d2deia1 automated match to d1s4ed2 complexed with gla, map |
PDB Entry: 2dei (more details), 1.7 Å
SCOPe Domain Sequences for d2deia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2deia2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]} dvsilvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgy ivrenarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgayga rltgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi
Timeline for d2deia2: