Lineage for d2deia2 (2dei A:179-350)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654323Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1654403Family d.58.26.0: automated matches [227186] (1 protein)
    not a true family
  6. 1654404Protein automated matches [226908] (3 species)
    not a true protein
  7. 1654411Species Pyrococcus horikoshii [TaxId:53953] [225135] (3 PDB entries)
  8. 1654414Domain d2deia2: 2dei A:179-350 [203972]
    Other proteins in same PDB: d2deia1
    automated match to d1s4ed2
    complexed with gla, map

Details for d2deia2

PDB Entry: 2dei (more details), 1.7 Å

PDB Description: crystal structure of galaktokinase from pyrococcus horikoshii with amp-pnp and galactose
PDB Compounds: (A:) Probable galactokinase

SCOPe Domain Sequences for d2deia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2deia2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dvsilvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgy
ivrenarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgayga
rltgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi

SCOPe Domain Coordinates for d2deia2:

Click to download the PDB-style file with coordinates for d2deia2.
(The format of our PDB-style files is described here.)

Timeline for d2deia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2deia1