Lineage for d2ddbc1 (2ddb C:4-153)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535431Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2535432Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2535462Family d.111.1.0: automated matches [227200] (1 protein)
    not a true family
  6. 2535463Protein automated matches [226929] (4 species)
    not a true protein
  7. 2535471Species Pseudechis porphyriacus [TaxId:8671] [225219] (2 PDB entries)
  8. 2535474Domain d2ddbc1: 2ddb C:4-153 [203965]
    Other proteins in same PDB: d2ddba2, d2ddbb2, d2ddbc2, d2ddbd2
    automated match to d1rc9a1
    complexed with fmt, gol, na

Details for d2ddbc1

PDB Entry: 2ddb (more details), 1.9 Å

PDB Description: crystal structure of pseudecin from pseudechis porphyriacus
PDB Compounds: (C:) Pseudecin

SCOPe Domain Sequences for d2ddbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddbc1 d.111.1.0 (C:4-153) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
kcssskylyvcqycpagnirgsiatpyksg

SCOPe Domain Coordinates for d2ddbc1:

Click to download the PDB-style file with coordinates for d2ddbc1.
(The format of our PDB-style files is described here.)

Timeline for d2ddbc1: