Class g: Small proteins [56992] (94 folds) |
Fold g.19: Crisp domain-like [57545] (1 superfamily) disulfide-rich all-alpha fold |
Superfamily g.19.1: Crisp domain-like [57546] (3 families) |
Family g.19.1.0: automated matches [227153] (1 protein) not a true family |
Protein automated matches [226858] (4 species) not a true protein |
Species Pseudechis porphyriacus [TaxId:8671] [225220] (2 PDB entries) |
Domain d2ddbb2: 2ddb B:154-210 [203964] Other proteins in same PDB: d2ddba1, d2ddbb1, d2ddbc1, d2ddbd1 automated match to d1rc9a2 complexed with fmt, gol, na |
PDB Entry: 2ddb (more details), 1.9 Å
SCOPe Domain Sequences for d2ddbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddbb2 g.19.1.0 (B:154-210) automated matches {Pseudechis porphyriacus [TaxId: 8671]} ppcadcpsacvnrlctnpcnynndfsnckslakkskcqtewikkkcpascfchnkii
Timeline for d2ddbb2: