SCOPe 2.06: Domain d2ddbb2: 2ddb B:154-210

Lineage for d2ddbb2 (2ddb B:154-210)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (3 families)

5. Family g.19.1.0: automated matches [227153] (1 protein)
   not a true family

6. Protein automated matches [226858] (4 species)
   not a true protein

7. Species Pseudechis porphyriacus [TaxId:8671] [225220] (2 PDB entries)

8. Domain d2ddbb2: 2ddb B:154-210 [203964]
   Other proteins in same PDB: d2ddba1, d2ddbb1, d2ddbc1, d2ddbd1
   automated match to d1rc9a2
   complexed with fmt, gol, na

Details for d2ddbb2

PDB Entry: 2ddb, 1.9 Å

PDB Description: crystal structure of pseudecin from pseudechis porphyriacus

PDB Compounds: (B:) Pseudecin

SCOPe Domain Sequences for d2ddbb2:

Sequence; same for both SEQRES and ATOM records:

>d2ddbb2 g.19.1.0 (B:154-210) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
ppcadcpsacvnrlctnpcnynndfsnckslakkskcqtewikkkcpascfchnkii

Timeline for d2ddbb2:

• d2ddbb2 first appeared in SCOPe 2.03
  
• d2ddbb2 appears in SCOPe 2.05
  
• d2ddbb2 appears in SCOPe 2.07
  
• d2ddbb2 appears in the current release, SCOPe 2.08