Lineage for d2ddbb2 (2ddb B:154-210)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462301Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 1462302Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 1462315Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 1462316Protein automated matches [226858] (4 species)
    not a true protein
  7. 1462334Species Pseudechis porphyriacus [TaxId:8671] [225220] (2 PDB entries)
  8. 1462336Domain d2ddbb2: 2ddb B:154-210 [203964]
    Other proteins in same PDB: d2ddba1, d2ddbb1, d2ddbc1, d2ddbd1
    automated match to d1rc9a2
    complexed with fmt, gol, na

Details for d2ddbb2

PDB Entry: 2ddb (more details), 1.9 Å

PDB Description: crystal structure of pseudecin from pseudechis porphyriacus
PDB Compounds: (B:) Pseudecin

SCOPe Domain Sequences for d2ddbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddbb2 g.19.1.0 (B:154-210) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
ppcadcpsacvnrlctnpcnynndfsnckslakkskcqtewikkkcpascfchnkii

SCOPe Domain Coordinates for d2ddbb2:

Click to download the PDB-style file with coordinates for d2ddbb2.
(The format of our PDB-style files is described here.)

Timeline for d2ddbb2: