SCOPe 2.05: Domain d2ddbb1: 2ddb B:2-153

Lineage for d2ddbb1 (2ddb B:2-153)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.0: automated matches [227200] (1 protein)
   not a true family

6. Protein automated matches [226929] (3 species)
   not a true protein

7. Species Pseudechis porphyriacus [TaxId:8671] [225219] (2 PDB entries)

8. Domain d2ddbb1: 2ddb B:2-153 [203963]
   Other proteins in same PDB: d2ddba2, d2ddbb2, d2ddbc2, d2ddbd2
   automated match to d1rc9a1
   complexed with fmt, gol, na

Details for d2ddbb1

PDB Entry: 2ddb, 1.9 Å

PDB Description: crystal structure of pseudecin from pseudechis porphyriacus

PDB Compounds: (B:) Pseudecin

SCOPe Domain Sequences for d2ddbb1:

Sequence; same for both SEQRES and ATOM records:

>d2ddbb1 d.111.1.0 (B:2-153) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
kknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgk
lrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligca
sakcssskylyvcqycpagnirgsiatpyksg

Timeline for d2ddbb1:

• d2ddbb1 first appeared in SCOPe 2.03
  
• d2ddbb1 appears in SCOPe 2.04
  
• d2ddbb1 appears in SCOPe 2.06
  
• d2ddbb1 appears in the current release, SCOPe 2.08