Lineage for d2ddbb1 (2ddb B:2-153)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428408Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 1428409Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 1428438Family d.111.1.0: automated matches [227200] (1 protein)
    not a true family
  6. 1428439Protein automated matches [226929] (2 species)
    not a true protein
  7. 1428445Species Pseudechis porphyriacus [TaxId:8671] [225219] (2 PDB entries)
  8. 1428447Domain d2ddbb1: 2ddb B:2-153 [203963]
    Other proteins in same PDB: d2ddba2, d2ddbb2, d2ddbc2, d2ddbd2
    automated match to d1rc9a1
    complexed with fmt, gol, na

Details for d2ddbb1

PDB Entry: 2ddb (more details), 1.9 Å

PDB Description: crystal structure of pseudecin from pseudechis porphyriacus
PDB Compounds: (B:) Pseudecin

SCOPe Domain Sequences for d2ddbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddbb1 d.111.1.0 (B:2-153) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
kknyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgk
lrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligca
sakcssskylyvcqycpagnirgsiatpyksg

SCOPe Domain Coordinates for d2ddbb1:

Click to download the PDB-style file with coordinates for d2ddbb1.
(The format of our PDB-style files is described here.)

Timeline for d2ddbb1: