Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
Superfamily d.111.1: PR-1-like [55797] (2 families) |
Family d.111.1.0: automated matches [227200] (1 protein) not a true family |
Protein automated matches [226929] (3 species) not a true protein |
Species Pseudechis porphyriacus [TaxId:8671] [225219] (2 PDB entries) |
Domain d2ddba1: 2ddb A:4-153 [203961] Other proteins in same PDB: d2ddba2, d2ddbb2, d2ddbc2, d2ddbd2 automated match to d1rc9a1 complexed with fmt, gol, na |
PDB Entry: 2ddb (more details), 1.9 Å
SCOPe Domain Sequences for d2ddba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddba1 d.111.1.0 (A:4-153) automated matches {Pseudechis porphyriacus [TaxId: 8671]} nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa kcssskylyvcqycpagnirgsiatpyksg
Timeline for d2ddba1: