Lineage for d2ddad2 (2dda D:155-211)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261052Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 2261053Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 2261066Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 2261067Protein automated matches [226858] (4 species)
    not a true protein
  7. 2261080Species Pseudechis australis [TaxId:8670] [225218] (1 PDB entry)
  8. 2261084Domain d2ddad2: 2dda D:155-211 [203960]
    Other proteins in same PDB: d2ddaa1, d2ddab1, d2ddac1, d2ddad1
    automated match to d1rc9a2
    complexed with fmt, gol, na

Details for d2ddad2

PDB Entry: 2dda (more details), 2.25 Å

PDB Description: Crystal structure of pseudechetoxin from Pseudechis australis
PDB Compounds: (D:) Pseudechetoxin

SCOPe Domain Sequences for d2ddad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddad2 g.19.1.0 (D:155-211) automated matches {Pseudechis australis [TaxId: 8670]}
ppcadcpsacvnklctnpckrnndfsnckslakkskcqtewikkkcpascfchnkii

SCOPe Domain Coordinates for d2ddad2:

Click to download the PDB-style file with coordinates for d2ddad2.
(The format of our PDB-style files is described here.)

Timeline for d2ddad2: