Lineage for d43cab_ (43ca B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451450Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (35 PDB entries)
  8. 451481Domain d43cab_: 43ca B: [20395]
    Other proteins in same PDB: d43caa_, d43cac_, d43cae_, d43cag_

Details for d43cab_

PDB Entry: 43ca (more details), 2.3 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol

SCOP Domain Sequences for d43cab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43cab_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5}
qvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsieyn
palksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs

SCOP Domain Coordinates for d43cab_:

Click to download the PDB-style file with coordinates for d43cab_.
(The format of our PDB-style files is described here.)

Timeline for d43cab_: