Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain [48883] (2 PDB entries) |
Domain d43cab_: 43ca B: [20395] |
PDB Entry: 43ca (more details), 2.3 Å
SCOP Domain Sequences for d43cab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d43cab_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain} qvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsieyn palksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
Timeline for d43cab_: