SCOPe 2.08: Domain d2dc5a2: 2dc5 A:93-225

Lineage for d2dc5a2 (2dc5 A:93-225)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225088] (3 PDB entries)

8. Domain d2dc5a2: 2dc5 A:93-225 [203948]
   Other proteins in same PDB: d2dc5a1, d2dc5a3, d2dc5b1, d2dc5b3
   automated match to d1bg5a1

Details for d2dc5a2

PDB Entry: 2dc5, 1.6 Å

PDB Description: Crystal structure of mouse glutathione S-transferase, mu7 (GSTM7) at 1.6 A resolution

PDB Compounds: (A:) Glutathione S-transferase, mu 7

SCOPe Domain Sequences for d2dc5a2:

Sequence; same for both SEQRES and ATOM records:

>d2dc5a2 a.45.1.0 (A:93-225) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lcgeteeerirvdilenqlmdnrmvlarlcynadfeklkpgyleqlpgmmrlyseflgkr
pwfagdkitfvdfiaydvlernqvfeakcldafpnlkdfiarfeglkkisdymktsrflp
rpmftkmatwgsn

Timeline for d2dc5a2:

• d2dc5a2 first appeared in SCOPe 2.03
  
• d2dc5a2 appears in SCOPe 2.07