Lineage for d43caa_ (43ca A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220220Species Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain [48883] (2 PDB entries)
  8. 220229Domain d43caa_: 43ca A: [20394]

Details for d43caa_

PDB Entry: 43ca (more details), 2.3 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol

SCOP Domain Sequences for d43caa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43caa_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain}
dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik

SCOP Domain Coordinates for d43caa_:

Click to download the PDB-style file with coordinates for d43caa_.
(The format of our PDB-style files is described here.)

Timeline for d43caa_: