Lineage for d43c9f_ (43c9 F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8053Species Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain [48883] (2 PDB entries)
  8. 8059Domain d43c9f_: 43c9 F: [20391]

Details for d43c9f_

PDB Entry: 43c9 (more details), 2.2 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody

SCOP Domain Sequences for d43c9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43c9f_ b.1.1.1 (F:) Immunoglobulin (variable domains of L and H chains) {Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain}
gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey
npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs

SCOP Domain Coordinates for d43c9f_:

Click to download the PDB-style file with coordinates for d43c9f_.
(The format of our PDB-style files is described here.)

Timeline for d43c9f_: