Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain [48883] (2 PDB entries) |
Domain d43c9f_: 43c9 F: [20391] |
PDB Entry: 43c9 (more details), 2.2 Å
SCOP Domain Sequences for d43c9f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d43c9f_ b.1.1.1 (F:) Immunoglobulin (variable domains of L and H chains) {Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain} gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
Timeline for d43c9f_: