Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [225174] (1 PDB entry) |
Domain d2d4ab2: 2d4a B:141-308 [203902] Other proteins in same PDB: d2d4aa1, d2d4ab1, d2d4ac1, d2d4ad1 automated match to d1guya2 |
PDB Entry: 2d4a (more details), 2.87 Å
SCOPe Domain Sequences for d2d4ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4ab2 d.162.1.0 (B:141-308) automated matches {Aeropyrum pernix [TaxId: 56636]} sgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvggvplehlmskeeie evvsetvnagakitelrgyssnygpaaglvltveaikrdskriypyslylqgeygyndiv aevpavigksgieriielpltedekrkfdeavqavkklvetlppqlre
Timeline for d2d4ab2: