SCOPe 2.08: Domain d2d4ab2: 2d4a B:141-308

Lineage for d2d4ab2 (2d4a B:141-308)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:56636] [225174] (1 PDB entry)

8. Domain d2d4ab2: 2d4a B:141-308 [203902]
   Other proteins in same PDB: d2d4aa1, d2d4ab1, d2d4ac1, d2d4ad1
   automated match to d1guya2

Details for d2d4ab2

PDB Entry: 2d4a, 2.87 Å

PDB Description: Structure of the malate dehydrogenase from Aeropyrum pernix

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2d4ab2:

Sequence; same for both SEQRES and ATOM records:

>d2d4ab2 d.162.1.0 (B:141-308) automated matches {Aeropyrum pernix [TaxId: 56636]}
sgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvggvplehlmskeeie
evvsetvnagakitelrgyssnygpaaglvltveaikrdskriypyslylqgeygyndiv
aevpavigksgieriielpltedekrkfdeavqavkklvetlppqlre

Timeline for d2d4ab2:

• d2d4ab2 first appeared in SCOPe 2.03
  
• d2d4ab2 appears in SCOPe 2.07