Lineage for d2d4ab2 (2d4a B:141-308)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 2557404Species Aeropyrum pernix [TaxId:56636] [225174] (1 PDB entry)
  8. 2557406Domain d2d4ab2: 2d4a B:141-308 [203902]
    Other proteins in same PDB: d2d4aa1, d2d4ab1, d2d4ac1, d2d4ad1
    automated match to d1guya2

Details for d2d4ab2

PDB Entry: 2d4a (more details), 2.87 Å

PDB Description: Structure of the malate dehydrogenase from Aeropyrum pernix
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2d4ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4ab2 d.162.1.0 (B:141-308) automated matches {Aeropyrum pernix [TaxId: 56636]}
sgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvggvplehlmskeeie
evvsetvnagakitelrgyssnygpaaglvltveaikrdskriypyslylqgeygyndiv
aevpavigksgieriielpltedekrkfdeavqavkklvetlppqlre

SCOPe Domain Coordinates for d2d4ab2:

Click to download the PDB-style file with coordinates for d2d4ab2.
(The format of our PDB-style files is described here.)

Timeline for d2d4ab2: