SCOPe 2.08: Domain d2d4aa1: 2d4a A:1-140

Lineage for d2d4aa1 (2d4a A:1-140)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:56636] [225173] (1 PDB entry)

8. Domain d2d4aa1: 2d4a A:1-140 [203899]
   Other proteins in same PDB: d2d4aa2, d2d4ab2, d2d4ac2, d2d4ad2
   automated match to d1guya1

Details for d2d4aa1

PDB Entry: 2d4a, 2.87 Å

PDB Description: Structure of the malate dehydrogenase from Aeropyrum pernix

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2d4aa1:

Sequence, based on SEQRES records:

>d2d4aa1 c.2.1.0 (A:1-140) automated matches {Aeropyrum pernix [TaxId: 56636]}
mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
amtyvmykktgfprervigf

Sequence, based on observed residues (ATOM records):

>d2d4aa1 c.2.1.0 (A:1-140) automated matches {Aeropyrum pernix [TaxId: 56636]}
mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
syedmrgsdivlvtagiglleanantmadlaekikayakdaivvittnpvdamtyvmykk
tgfprervigf

Timeline for d2d4aa1:

• d2d4aa1 first appeared in SCOPe 2.03
  
• d2d4aa1 appears in SCOPe 2.07