Lineage for d43c9b_ (43c9 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353475Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2353497Domain d43c9b_: 43c9 B: [20387]
    Other proteins in same PDB: d43c9a_, d43c9c_, d43c9e_, d43c9g_
    part of sterolytic and amidolytic Fv 43c9

Details for d43c9b_

PDB Entry: 43c9 (more details), 2.2 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody
PDB Compounds: (B:) protein (immunoglobulin (heavy chain))

SCOPe Domain Sequences for d43c9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43c9b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey
npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs

SCOPe Domain Coordinates for d43c9b_:

Click to download the PDB-style file with coordinates for d43c9b_.
(The format of our PDB-style files is described here.)

Timeline for d43c9b_: