Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
Protein automated matches [226913] (9 species) not a true protein |
Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (7 PDB entries) |
Domain d2d1za2: 2d1z A:322-436 [203862] Other proteins in same PDB: d2d1za1, d2d1zb1 automated match to d1xyfa1 complexed with gol, so4; mutant |
PDB Entry: 2d1z (more details), 1.6 Å
SCOPe Domain Sequences for d2d1za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1za2 b.42.2.0 (A:322-436) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]} rcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtgngtkvqiys cwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqrwtrt
Timeline for d2d1za2: