Lineage for d43c9a_ (43c9 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287964Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (22 PDB entries)
  8. 287975Domain d43c9a_: 43c9 A: [20386]
    Other proteins in same PDB: d43c9b_, d43c9d_, d43c9f_, d43c9h_

Details for d43c9a_

PDB Entry: 43c9 (more details), 2.2 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody

SCOP Domain Sequences for d43c9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43c9a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik

SCOP Domain Coordinates for d43c9a_:

Click to download the PDB-style file with coordinates for d43c9a_.
(The format of our PDB-style files is described here.)

Timeline for d43c9a_: